PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g05100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 312aa    MW: 35611.6 Da    PI: 6.0068
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g05100genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.3e-1886139356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  CA11g05100  86 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 139
                 456899***********************************************9 PP

2HD-ZIP_I/II131.92.4e-4285177193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdye+Lkr++da+k+en++L++++++L++e+++
   CA11g05100  85 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYEVLKRQFDAVKAENDALQTQNQKLHAEIMA 177
                  69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-1962142IPR009057Homeodomain-like
SuperFamilySSF466892.48E-1977143IPR009057Homeodomain-like
PROSITE profilePS5007117.32981141IPR001356Homeobox domain
SMARTSM003891.8E-1784145IPR001356Homeobox domain
PfamPF000463.2E-1586139IPR001356Homeobox domain
CDDcd000861.10E-1586142No hitNo description
PRINTSPR000311.3E-5112121IPR000047Helix-turn-helix motif
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5121137IPR000047Helix-turn-helix motif
PfamPF021832.8E-16141182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MTCTNYEMAF FPTNFMLQSP HEDEHHEPST SLTPILPSCS PQDFHGIASF LGKRSMSFSG  60
MEGNNTCEEN HGEDDLSDDG SQAGEKKRRL NMEQVKTLEK NFELGNKLEP ERKMQLARAL  120
GLQPRQIAIW FQNRRARWKT KQLEKDYEVL KRQFDAVKAE NDALQTQNQK LHAEIMALKN  180
REQPTESINL NKETEGSCSN RSENSSEIKL DISRTPAIDS PLSNHPNISS RPFFPPSMIR  240
PNNNNNNNNG VVVPHQLFHI NSSSSRPDLK LMDQNTTTNS TNIKEESLSN MFCGIDDQTS  300
FWPWLEQQHF N*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0115560.0AF011556.1 Lycopersicon esculentum jasmonic acid 1 (LEJA1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016548012.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-124ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLK4BWP40.0K4BWP4_SOLLC; Uncharacterized protein
STRINGSolyc05g007180.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-125HD-ZIP family protein